![]() Anti-human pcsk9 monoclonal antibody and use thereof
专利摘要:
The invention discloses a brand-new PCSK9 antibody. The PCSK9 antibody is sieved through a phage display technology, then a full-length gene sequence is obtained through a gene engineering technology, and applied to preparation of the antibody, and the prepared antibody is high in yield and short in period and is a humanized antibody. The invention further discloses an anti-tumor effect of the antihuman PCSK9 antibody, which expands the way of thinking for research on occurrence and development of tumors in the future, and lays foundations for preparing the antihuman PCSK9 antibody into monoclonal antibody medicines used for treating tumors in the later period. 公开号:EP3705497A1 申请号:EP19817923.6 申请日:2019-04-29 公开日:2020-09-09 发明作者:Zhigang Guo;Li Jing;Ali Wajid 申请人:Zhejiang Blue Shield Pharmaceutical Co Ltd; IPC主号:C07K16-00
专利说明:
[0001] The present invention relates to a gene engineering antibody technology, and more particularly, to a preparation method of a fully humanized monoclonal antibody and a full-length antibody aiming at PCSK9 and an application thereof in anti-tumor. BACKGROUND [0002] PCSK9, formerly known as a Neural Apoptosis-Regulated Convertase 1 (NARC-1), is the 9th member of a preprotein convertase subtilisin family discovered and reported for the first time by Canadian biochemist Nabil Seidah and the team. Main physiological functions of the PCSK9 are to mediate degradation of a Low Density Lipoprotein Receptor (LDLR) of a hepatocyte, and reduce uptake of LDL-cholesterol (LDL-c) of plasma by the LDLR, leading to increase of an LDL-c level. Targeted inhibition of the PCSK9 is beneficial for reducing the LDL-c level. Therefore, the PCSK9 becomes a hot new target for lipid lowering, and a PCSK9 inhibitor is emerged. At present, there are about 10 pharmaceutical companies producing and developing the PCSK9 inhibitor, comprising Sanofi, Amgen, Novartis, Pfizer, Squibb, etc. About half of the PCSK9 inhibitors are monoclonal antibodies and are in a leading stage of clinical medicine research. At present, most PCSK9 inhibitors are used to treat dyslipidemia, metabolic diseases, hypercholesterolemia, inflammatory diseases, etc., and few people have studied or reported the tumor inhibiting effects. [0003] A tumor has always been one of major threats to human health, and human beings have also been committed to the study of the tumor, hoping to find more effective methods to treat the tumor. However, there are still unmet medical needs for a more effective and less toxic therapy. Overcoming the tumor has always been a problem that scholars are eager to solve, and through in-depth research on the cause and pathogenesis of the tumor, a series of tumor treatment technologies have been developed now, such as surgical resection, radiotherapy and chemotherapy, etc. However, these methods have shortcomings such as a low cure rate, a large side effect of medicine, etc., and the tumor treatment is still a big problem perplexing the medical field. An antigen corresponding to a monoclonal antibody has a high degree of specificity, and a monoclonal antibody specifically bound to a specific molecular target may be prepared. As a research hotspot in the field of biological medicines, a monoclonal antibody medicine has the characteristics of strong targeting, high specificity and low toxic and side effects, and represents the latest development direction in the field of medicine treatment. [0004] A colon cancer, often referred to as a colorectal cancer or an intestinal cancer, is a cancer derived from uncontrolled cell growth in colon, rectum or appendix, and is the second most commonly diagnosed malignancy and the second most common cause of cancer death in the United States. At present, commonly used targeted medicines in the field of the colorectal cancer comprise two types of medicines targeting an epidermal growth factor receptor (EGFR) (referring to the drawing) and a vascular endothelial growth factor (VEGF), which specifically comprise bevacizumab, cetuximab and panizumab. [0005] At present, technologies for preparing the antibody generally comprise a hybridoma technology and a phage screening technology. Disadvantages of the hybridoma technology for sieving the antibody comprise long time, low yield, and low antibody purity, and the antibody produced by the technology is a murine antibody. Current patents on a preparation method of an antihuman PCSK9 monoclonal antibody are mostly to sieve a PCSK9 antibody through a phage sieving method in an early stage or to prepare a new PCSK9 antibody through a gene engineering method, and there are few methods for transfecting a constructed plasmid into a suspension cell and culturing and preparing the antibody through a cell supernatant in a late stage. SUMMARY [0006] Object of the invention: aiming at the technical problems in the prior art, the present invention provides an antihuman PCSK9 monoclonal antibody, and provides a preparation method and an application of the antihuman PCSK9 monoclonal antibody in preparing medicines. [0007] Technical solution: the present application provides an antihuman PCSK9 monoclonal antibody, wherein a CDR1, a CDR2 and a CDR3 of a VH of the antibody respectively have an amino acid sequence shown in SEQ ID NO:1-3, and a CDR1, a CDR2 and a CDR3 of a VL of the antibody respectively have an amino acid sequence shown in SEQ ID NO:4-6. [0008] Further, the VH of the antihuman PCSK9 monoclonal antibody has an amino acid sequence shown in SEQ ID NO:7, and the VL of the antihuman PCSK9 monoclonal antibody has an amino acid sequence shown in SEQ ID NO:8. [0009] The antihuman PCSK9 monoclonal antibody above is a fully humanized antibody. [0010] The present invention further discloses an application of the antihuman PCSK9 monoclonal antibody in preparing a medicine for treating a disease mediated by human PCSK9. [0011] Further, the present invention further discloses an application of the antihuman PCSK9 monoclonal antibody in preparing a medicine for treating a cancer, especially a colorectal cancer. [0012] According to the present invention, a humanized monoclonal antibody phage display library constructed and saved (a natural humanized Fab phage display library constructed according to the report of Hans J. W. de Haard et al. (Antibody PhageDisplay, 2002, p87-100)), with a storage capacity more than 1.0x1010, and a host of Escherichia coli TG1 is utilized to screen an Fab antibody against human PCSK9, and a complete full-length antibody is obtained by genetic engineering; and further, the antibody is found to be capable of effectively inhibiting growth of a colorectal cancer in a mouse model through an experiment, and growth of a tumor in a treatment group is found to be obviously inhibited in comparison with that in a control group through the experiment. [0013] The preparation method of the antihuman PCSK9 monoclonal antibody is as follows. Step 1: screening a target antibody according to the phage library [0014] A certain concentration of PCSK9 antigen is added into an immune tube and coated overnight, and a phage is washed and sealed, and added into the immune tube the next day to bind the antigen and the antibody; the immune tube is repeatedly turned over and stood, then washed with tween 20, and eluted; the eluted phage is neutralized with 1M tris-Hcl and infected with TGI, then a titer is determined and amplification and concentration are performed for next round of screening; after 4 rounds of screening, the eluted phage is infected with Escherichia coli TG1 and subjected to plate coating and monoclonal selection, and ELISA detection is further performed to screen out positive clones; DNA sequencing is performed on the screened antibody (named PA6) to obtain variable region of heavy chain and variable region of light chain sequences of the PA6. Step 2: expression and purification of an Fab fragment of a positive monoclonal PA6 antibody [0015] One of the monoclonal antibodies is selected for TG1 infection, and a plasmid is extracted; after Gene III is removed by enzyme digestion, the plasmid is transformed and subjected to extended culture, and then a colony is collected for purification. Step 3: expression and purification of a positive clone in a full-length antibody IgG1 form [0016] 1. Construction of a heavy chain expression plasmid: a CH1-VH part in the Fab fragment of the PA6 antibody is amplified by PCR, and the CH1-VH part is bound to an Fc fragment. A Kozak sequence, a signal peptide and a restriction enzyme site are then added to an N-terminal of a variable region of heavy chain VH. An amplified heavy chain fragment and an expression vector are digested by restriction enzymes NgoMIV and NheI, and the fragment is bound to the vector after enzyme digestion.2. Construction of a light chain expression plasmid: a complete light chain part of the Fab fragment of the PA6 antibody is amplified by PCR. A Kozak sequence, a signal peptide and a restriction enzyme site are added to an N-terminal of a variable region of light chain VL. An amplified light chain fragment and an expression vector are digested by restriction enzymes NgoMIV and NheI, and the fragment is bound to the vector after enzyme digestion.3. Induced expression: the constructed plasmid is transfected with CHO-S cells by using a transfection reagent, after transfection, when a cell viability recovers to about 90%, the cells are screened with puromycin and added with MTX at the same time for pressurization, with a pressurization concentration gradually increasing from 50 nM to 500 nM until the cells are in a relatively stable state. A supernatant of the cells is taken and ran in gel to identify an expression quantity of the PA6 antibody (Fig. 3); when the antibody is confirmed to be really expressed, the cells are spread into a 96-well plate for positive clone screening and subjected to ELISA detection. The screened positive clone is subjected to extended culture to a 250 ml shake flask and continuously cultured, and regularly added with a supplement. Then a cell supernatant is collected, and corresponding antibodies are purified, and a concentration of the antibodies is determined (Fig. 4). [0017] Step 4: purification of the cell supernatant: the supernatant at -80°C above is placed at 4°C for natural thawing, and the entire supernatant with a volume of about 150 ml is ultrafiltrated and concentrated to a total volume of about 10 ml by using an ultrafiltration tube of 15 ml 50KD (molecular weight cut-off), diluted twice with a bound buffer, and finally filtered with a 0.45µm filter membrane. rProtein G Beads are loaded into a 1 ml chromatography column, the chromatography is balanced with a bound solution of 5 times the column volume, then a sample is added into the balanced rProtein G Beads, and then washed with an impurity washing solution of 10 times the column volume, and finally, the bound antibody is eluted with an eluent of 5 times the column volume. The collected eluent is desalted and concentrated by using an ultrafiltration tube of 15 ml 50KD (molecular weight cut-off), and washed twice with a PBS during the period, and finally, about 1 ml of the concentrated solution is collected, and temporarily stored at 4°C. A concentration of a purified antibody is detected by a Bradford Protein Assay Kit, and the concentration is finally determined to be 2.775 mg/ml. An outflow component, an impurity washing component and an elution component are detected by using SDS-PAGE to observe a purification effect, and finally, a purity is indicated to be more than 95%. [0018] Beneficial effects: on one hand, the present invention utilizes a phage display technology to screen out the brand-new PCSK9 antibody, then obtains the full-length gene sequence through a genetic engineering technology, and applies the full-length gene sequence to antibody preparation, and the prepared antibody has a high yield and a short period, and is a humanized antibody; and on the other hand, an anti-tumor effect of the antihuman PCSK9 antibody is innovatively found (taking the colorectal cancer as an example), which expands the way of thinking for research on occurrence and development of tumors in the future, and lays foundations for preparing the antihuman PCSK9 antibody into monoclonal antibody medicines used for treating tumors in the later period. BRIEF DESCRIPTION OF THE DRAWINGS [0019] Fig. 1 shows SDS-PAGE identification results of a cell supernatant; Fig. 2 shows SDS-PAGE detection results of a PCSK9-purified antibody; Fig. 3 is a tumor inhibition curve of an antibody to nude mice; and Fig. 4 shows inhibition of the antibody on a tumor size of the nude mice.DETAILED DESCRIPTION [0020] The application is described in detail hereinafter with reference to specific embodiments. Embodiment 1 Screening of an Fab phage library to obtain an antihuman PCSK9 positive monoclonal antibody [0021] 1. A PCSK9 protein (GenScript Biotech Corporation) was diluted to a concentration of 100 ug/ml, and 1.5 ml of the PCSK9 protein was added into an immune tube, and coated overnight at 4°C. A coating buffer in the immune tube was discarded next day, and washed with a PBS for three times. 2% skimmed milk powder was prepared and sealed in the immune tube for 3 hours to 4 hours. Meanwhile, a natural humanized Fab phage display library constructed according to the report of Hans J. W. de Haard et al. (Antibody PhageDisplay, 2002, p87-100) was also sealed for 1 hour, then a phage was added into the immune tube, and turned over repeatedly for 2 hours, and the phage bound to the immune tube was eluted with 0.1% Tween 20 and neutralized. The neutralized phage was infected with TG1 for next round of screening.2. After 3 to 5 rounds of screening, the eluted phage was infected with Escherichia coli TG1 (Beyotime, D0389) and subjected to plate coating, then 100 clones were randomly selected for Elisa identification of the phage.3. The clones were inoculated in a 96-well plate and cultured at 37°C until OD600 reached about 0.5; a VSCM13 auxiliary phage was added, and cultured overnight; and the amplified phages were blocked with the 2% skimmed milk powder, respectively added into an ELISA plate coated with 1 µg/ml PCSK9 antigen and BSA (BSA is negative control), incubated at a room temperature for 1 hour, washed with PBST for 5 times, then added with a rabbit anti-M13 phage HRP conjugate (GE Healthcare Life Sciences), incubated at a room temperature for 1 hour, washed with PBST for 5 times, added with a TMB peroxy substrate, and read at 450 nm wavelength. Finally, a monoclonal antibody No. 6 with a high affinity was screened out as PA6.4. DNA sequencing was performed on the PA6 to obtain sequences of a variable region of heavy chain (VH) and a variable region of light chain (VL) of the PA6, wherein the complete sequences of the VH and the VL were shown in SEQ ID NO:7 and SEQ ID NO: 8, wherein a CDR1, a CDR2 and a CDR3 of the VH respectively had an amino acid sequence shown in SEQ ID NO:1-3, and a CDR1, a CDR2 and a CDR3 of the VL respectively had an amino acid sequence shown in SEQ ID NO:4-6. VH SEQ ID NO:7 EVQLEESGPELVKPSFVVKISCKASGYSFTGYVLNWVRQSHKVLWIGHINVCRESFYNQKF KDKASLTSRTAHVYIKMLTSEDSAVYYCVRGGMVCESDYWGQGTSVTVSSwherein, CDR1 SEQ ID NO: 1 GYVLN CDR2 SEQ ID NO:2 HINVCRESFYNQKFKD CDR3 SEQ ID NO:3 GGMVCESDY VL SEQ ID NO:8 DILMTQTPLTYSLGDSISCSGFQNIVGHLKLEWFLQKPQFGVKLLIYKVGYLVFSGVPDRFS GSGGTHLIKISRVEAEDLGVYYCFQGFSVTYTFGGGTKLEIKwherein, CDR1 SEQ ID NO:4 SGFQNIVGHLKLE CDR2 SEQ ID NO:5 KVGYLVF S CDR3 SEQ ID NO:6 FQGFSVTYT Embodiment 2 Expression and purification of an Fab fragment of a positive monoclonal PA6 antibody [0022] 1. A screened PA6 antibody with a high affinity was infected with TG1 and amplified, then a bacterial liquid was collected, a plasmid was extracted by a plasmid extraction kit (omega, D6950-01), and Gene III of the plasmid was removed.2. The obtained GeneIII-excised plasmid was transfected into Escherichia coli TG 1, cultured in a 2YTA medium at 37°C to a logarithmic phase, added with 1 mM IPTG, and subjected to induced expression at 37°C overnight. 3. A supernatant was collected by centrifugation and purified with a Protein A (CWBIO, CW0894S) to obtain a PA6 Fab protein.Embodiment 3 Expression and purification of a positive clone in a full-length antibody IgG1 form [0023] 1. Construction of a heavy chain expression plasmid: a CH1-VH part in an Fab fragment of a PA6 antibody was amplified by PCR, and the CH1-VH part was bound to a Fc fragment (referring to a variable region gene of a fully humanized monoclonal antibody against PCSK9 and an application thereof for details, with the patent No. CN 104861071 A ) stored in a laboratory by using a T4 ligase. Then, a Kozak sequence (AAG CTT GCCACC), a signal peptide and a restriction enzyme site were added to an N-terminal of a variable region of heavy chain VH. An amplified heavy chain fragment and an expression vector UCOE-Mu-P were digested by restriction enzymes NgoMIV and NheI, and the fragment was bound to the vector after enzyme digestion.2. Construction of a light chain expression plasmid: a complete light chain part of the Fab fragment of the PA6 antibody was amplified by PCR. A Kozak sequence (AAG CTT GCCACC), a signal peptide and a restriction enzyme site were added to an N-terminal of a variable region of light chain VL. An amplified light chain fragment and an expression vector UCOE-Mu-P were digested by restriction enzymes NgoMIV and NheI, and the fragment was bound to the vector after enzyme digestion.3. Induced expression: the heavy and light chain plasmids expressing the PCSK9 antibody were co-transfected into CHO-S cells (BeNa Bio, 338010) with a transfection reagent; after a cell viability was stable, MTX (50 nm, 100 nm, 200 nm and 500nm) and puromycin (Solarbio, P8230) were added for pressure screening until a cell state was stable, and a cell supernatant was taken and ran in gel to see whether a target antibody thereof was expressed. After the expression was confirmed, the cells were spread into a 96-well plate with an average of 2 cells per well. After the cells grew to a monoclonal state, a supernatant was taken for ELISA detection, after 2 to 3 rounds of subclone screening, then the cells were subjected to extended culture to a 250 ml shake flask, and regularly added with a supplement to increase an antibody production, and the cells in the shake flask were sampled, counted and analyzed when the supplement was added each time. Specifically, as shown in Table 1-3, cell strains stably expressing the antihuman PCSK9 monoclonal antibody were subjected to extended culture, and used to prepare the antibody through shake flask culture, three independent experiments were respectively performed, the cells were extended to the shake flask, and two shake flasks were selected for parallel experiments. Specific results of sample counting of one and/or two shake flasks were randomly taken every 2 days to 3 days and the cells were treated. Table 1 Time Cell density (106) Cell viability (%) Cell treatment Cell culture method May 21, 2018 0.8 99 Extended to 250 ml shake flask for 60 ml respectively CD-FortiCHO + 4mM of Glutamax + 1% of ACA May 23, 2018 2.18/6.20 98/98 Supplemented with 5% of Feed C (with white precipitate on flask body) May 25, 2018 11.6/5.3 97/98 Supplemented with 10% of Feed C May 28, 2018 Basically died/2.7 10/48.2 Collected 80 ml of supernatant respectively Table 2 Time Cell density (106) Cell viability (%) Cell treatment Cell culture method June 1, 2018 0.8 99 Extended to two 250 ml shake flasks for 80 ml respectively CD-FortiCHO+ 4mM of Glutamax + 1% of ACA June 4, 2018 11.3/6.8 98/97 Supplemented with 10% of Feed C June 6, 2018 14.15/8.0 98/98 Supplemented with 10% of Feed C June 8, 2018 4.15/5.8 85.3/72.5 Collected 160 ml of supernatant respectively Table 3 Time Cell density (106) Cell viability (%) Cell treatment Cell culture method June 10,2018 0.8 95 Extended to 250 ml shake flask for 60 ml respectively CD-FortiCHO + 4mM of Glutamax + 1% of ACA + 1% of HT June 11, 2018 1.0 98 Untreated June 14, 2018 4.34 98 Supplemented with 1ml of Glutamax Supplemented with 10% of Feed2 June 16, 2018 7.56 99 Supplemented with 10% of Feed2 June 18, 2018 10.75 99 Supplemented with 10% of Feed2 June 21, 2018 6.5/5.15 97 Untreated June 23, 2018 ---- ---- Collected 80 ml of supernatant respectively [0024] When the cell viability in the shake flask reached 70% or below, the cell supernatant was collected, and a sample was taken for SDS-PAGE identification. Results were shown in Fig. 1. It could be seen that there was really a target band in the supernatant to express the antihuman PCSK9 antibody, and the supernatant was purified in a later stage. Embodiment 4 Purification of a PCSK9 monoclonal antibody1. Preparation of a buffer [0025] Water and a buffer were filtered with a 0.45 µm filter membrane before use.Binding/impurity washing buffer: 0.15 M NaCl, 20 mM Na2HPO4, pH 7.0.Elution buffer: 0.1 M glycine, pH 3.0.Neutralization buffer: 1 M Tris-HCl, pH 8.5. 2. Preparation of a sample [0026] The supernatant at -80°C above was placed at 4°C for natural thawing, and the entire supernatant with a volume of about 150 ml was ultrafiltrated and concentrated to a total volume of about 10 ml by using an ultrafiltration tube (Thermo) of 15 ml 50KD (molecular weight cut-off), diluted twice with the bound buffer, and finally filtered with the 0.45 µm filter membrane to reduce impurities, thus improving a protein purification efficiency and preventing a column from blockage. 3. Purification of the sample [0027] 1) rProtein G Beads were loaded into a 1 ml chromatography column, and chromatography was balanced with a bound solution of 5 times the column volume, so that a filler was placed in the same buffer system as the target antibody to protect the antibody.2) The sample was added into the well-balanced rProtein G Beads to ensure full contact between the target antibody and the rProtein G Beads, thus improving a recovery rate of the target antibody, and an outflow was collected.3) The sample was washed with an impurity washing solution of 10 times the column volume to remove a non-specifically adsorbed foreign protein, and the impurity washing solution was collected.4) The bound antibody was eluted with an eluent of 5 times the column volume, and the eluent was collected into a centrifuge tube added with the neutralized buffer in advance (5 ml of eluent was added with 0.5 ml of neutralized buffer), namely a target antibody component.5) The collected eluate was desalted and concentrated by using an ultrafiltration tube of 15 ml 50KD (molecular weight cut-off), and washed twice with a PBS during the period, and finally, about 1 ml of the concentrated solution was collected, and temporarily stored at 4°C for concentration and purity detection. 4. Concentration and purity detection of a purified antibody [0028] A concentration of a purified antibody was detected by a Bradford Protein Assay Kit, and the concentration was finally determined to be 2.775 mg/ml. An outflow component, an impurity washing component and an elution component were detected by using SDS-PAGE to observe a purification effect, and as shown in Fig. 2, according to the arrow in the figure, obvious heavy and light chain belts appeared after sample reduction, and finally, the purity was indicated to be more than 95%. Embodiment 5 Application of an antihuman PCSK9 antibody obtained above in treating a tumor [0029] After the antibody is purified, a concentration was marked, and the antibody was sub-packaged and stored at -80°C. A colon cancer cell (BeNa Bio, BNCC100275) was inoculated to a mouse, the PCSK9 antibody was used to treat the mouse, and a tumor size was observed. Specific operation steps were as follows: 1. 10 female nude mice in 6 weeks were purchased, SW480 cells were extended into 12 large dishes of 10 cm, and a cell inoculation amount of each mouse was ensured to be 5x106. 2. The cells were digested by trypsin, and collected, and a cell inoculation amount of each mouse was ensured to be 5x106. The 10 nude mice were divided into a control group and an antibody group, the cells were injected subcutaneously, and the mice were observed until a tumor grew to a certain size (about 200 mm3 in volume). 3. The PCSK9 antibody was prepared, and each nude mouse in the antibody group was injected with a dose of 10 mg/g in a tail intravenous mode according to a body weight; and the nude mice in the control group were injected with the same volume of normal saline, a tumor size of each nude mouse was measured every other week, and the antibody was continuously injected. Then, the tumor size was measured, and the experiment operation was repeated every week for one month. 4. Finally, tumors of the nude mice were taken out, and tumor sizes of the experimental group and the control group were compared and analyzed. Results were shown in Fig. 3 and Fig. 4. As shown in Fig. 3, after the tumor sizes of the nude mice were analyzed, tumor growth of the treatment group was found to be obviously inhibited compared with that of the control group. As shown in Fig. 4, the tumors of the mice were taken out, and the upper row was the control group and the lower row was the treatment group. The results showed that the tumor growth of the antibody group was significantly inhibited compared with that of the control group.
权利要求:
Claims (7) [0001] An antihuman PCSK9 monoclonal antibody, wherein a CDR1, a CDR2 and a CDR3 of a VH of the antibody respectively have an amino acid sequence shown in SEQ ID NO:1-3, and a CDR1, a CDR2 and a CDR3 of a VL of the antibody respectively have an amino acid sequence shown in SEQ ID NO:4-6. [0002] The antihuman PCSK9 monoclonal antibody according to claim 1, wherein the VH of the antibody has an amino acid sequence shown in SEQ ID NO:7, and the VL of the antibody has an amino acid sequence shown in SEQ ID NO:8. [0003] The antihuman PCSK9 monoclonal antibody according to claim 1 or 2 is a fully humanized antibody. [0004] The antihuman PCSK9 monoclonal antibody according to claim 1 or 2 is an Fab fragment. [0005] An application of the antihuman PCSK9 monoclonal antibody according to any one of claims 1 to 4 in preparing a medicine for treating a disease mediated by human PCSK9. [0006] An application of the antihuman PCSK9 monoclonal antibody according to any one of claims 1 to 4 in preparing a medicine for treating a cancer. [0007] An application of the antihuman PCSK9 monoclonal antibody according to any one of claims 1 to 4 in preparing a medicine for treating a colorectal cancer.
类似技术:
公开号 | 公开日 | 专利标题 JP6518005B2|2019-05-22|PD-L1 antibody JP6224759B2|2017-11-01|Anti-B7-H3 antibody CN105331586B|2020-09-15|Tumor precision T cell containing efficient killing and initiating mechanism and application thereof JP2020125301A|2020-08-20|Tri-specific binding proteins and use methods thereof AU2016205518B2|2021-02-04|Anti-PD-L1 antibodies US20180311291A1|2018-11-01|Oncolytic adenoviruses armed with heterologous genes CN105377297B|2019-09-17|Antibody lock for pharmaceutical grade protein inactivation CN106084052B|2019-12-27|anti-CD 47 monoclonal antibody and application thereof JP6605444B2|2019-11-13|Fusion immunoregulatory protein and production method thereof Rodgers et al.2016|Therapeutic monoclonal antibodies and derivatives: Historical perspectives and future directions AU2010299895B2|2014-03-13|Anti-CD33 antibodies and use thereof for immunotargeting in treating CD33-associated illnesses WO2015085847A1|2015-06-18|Pd-1 antibody, antigen-binding fragment thereof, and medical application thereof JP4373782B2|2009-11-25|Antigen-binding dimers and multimeric structures US7318924B2|2008-01-15|Antibodies against cancer KR20160077155A|2016-07-01|Specific anti-cd38 antibodies for treating human cancers EP3503918B1|2020-09-30|Adenovirus armed with bispecific t cell engager | KR20170137067A|2017-12-12|Anti-PVRIG antibody and methods of use CN104479020B|2019-08-02|A kind of anti-PD-1 human antibody JP2018531219A6|2018-12-13|PD-L1 antibody JP2018522564A|2018-08-16|Anti-glypican 3 antibody and use thereof WO2018036472A1|2018-03-01|Anti-pd1 monoclonal antibody, pharmaceutical composition thereof and use thereof JP5631733B2|2014-11-26|Anti-EpCAM antibodies and uses thereof JP2017149773A|2017-08-31|NEUTRALIZING ANTIBODIES TO MAJOR EXOTOXINS TcdA AND TcdB OF CLOSTRIDIUM DIFFICILE US20090291072A1|2009-11-26|Means and methods for the treatment of tumorous diseases US20170240651A1|2017-08-24|Agr2 blocking antibody and use thereof
同族专利:
公开号 | 公开日 EP3705497A4|2021-02-24| WO2020151122A1|2020-07-30| CN109776680A|2019-05-21| CN109776680B|2020-05-12|
引用文献:
公开号 | 申请日 | 公开日 | 申请人 | 专利标题
法律状态:
2019-12-21| STAA| Information on the status of an ep patent application or granted ep patent|Free format text: STATUS: UNKNOWN | 2020-08-03| STAA| Information on the status of an ep patent application or granted ep patent|Free format text: STATUS: THE INTERNATIONAL PUBLICATION HAS BEEN MADE | 2020-08-07| PUAI| Public reference made under article 153(3) epc to a published international application that has entered the european phase|Free format text: ORIGINAL CODE: 0009012 | 2020-08-07| STAA| Information on the status of an ep patent application or granted ep patent|Free format text: STATUS: REQUEST FOR EXAMINATION WAS MADE | 2020-09-09| AX| Request for extension of the european patent|Extension state: BA ME | 2020-09-09| AK| Designated contracting states|Kind code of ref document: A1 Designated state(s): AL AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL PT RO RS SE SI SK SM TR | 2020-09-09| 17P| Request for examination filed|Effective date: 20191220 | 2021-02-24| A4| Supplementary search report drawn up and despatched|Effective date: 20210125 | 2021-02-24| RIC1| Information provided on ipc code assigned before grant|Ipc: A61P 35/00 20060101ALI20210119BHEP Ipc: C07K 16/40 20060101AFI20210119BHEP Ipc: A61K 39/395 20060101ALI20210119BHEP Ipc: C12N 15/13 20060101ALI20210119BHEP | 2021-11-12| STAA| Information on the status of an ep patent application or granted ep patent|Free format text: STATUS: EXAMINATION IS IN PROGRESS | 2021-12-15| 17Q| First examination report despatched|Effective date: 20211112 |
优先权:
[返回顶部]
申请号 | 申请日 | 专利标题 相关专利
Sulfonates, polymers, resist compositions and patterning process
Washing machine
Washing machine
Device for fixture finishing and tension adjusting of membrane
Structure for Equipping Band in a Plane Cathode Ray Tube
Process for preparation of 7 alpha-carboxyl 9, 11-epoxy steroids and intermediates useful therein an
国家/地区
|